Recombinant Human CDH2 Protein, GST-Tagged

• Cat.No.: CDH2-0984H
• Product Overview: Human CDH2 partial ORF (NP_001783, 807 a.a. - 906 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone. [provided by RefSeq, Nov 2015]
• Molecular Mass: 36.74 kDa
• AA Sequence: RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ]
• Official Symbol: CDH2
• Synonyms: CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin; N-cadherin 1; neural cadherin; neural-cadherin; cadherin 2, N-cadherin (neuronal); calcium-dependent adhesion protein, neuronal; CDw325
• Gene ID: 1000
• mRNA Refseq: NM_001792
• Protein Refseq: NP_001783
• MIM: 114020
• UniProt ID: P19022