Recombinant Human CDH2 Protein, GST-Tagged

Cat.No. : CDH2-0984H
Product Overview : Human CDH2 partial ORF (NP_001783, 807 a.a. - 906 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone. [provided by RefSeq, Nov 2015]
Molecular Mass : 36.74 kDa
AA Sequence : RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ]
Official Symbol CDH2
Synonyms CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin; N-cadherin 1; neural cadherin; neural-cadherin; cadherin 2, N-cadherin (neuronal); calcium-dependent adhesion protein, neuronal; CDw325;
Gene ID 1000
mRNA Refseq NM_001792
Protein Refseq NP_001783
MIM 114020
UniProt ID P19022

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDH2 Products

Required fields are marked with *

My Review for All CDH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon