Recombinant Human CDH17 Protein, GST-Tagged

• Cat.No.: CDH17-0978H
• Product Overview: Human CDH17 partial ORF (NP_004054, 24 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2009]
• Molecular Mass: 37.62 kDa
• AA Sequence: EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDH17 cadherin 17, LI cadherin (liver-intestine) [ Homo sapiens ]
• Official Symbol: CDH17
• Synonyms: CDH17; cadherin 17, LI cadherin (liver-intestine); cadherin-17; cadherin; HPT 1; LI cadherin; LI-cadherin; cadherin-16; HPT-1 cadherin; liver-intestine cadherin; human peptide transporter 1; intestinal peptide-associated transporter HPT-1; human intestinal peptide-associated transporter HPT-1; HPT1; CDH16; HPT-1; FLJ26931; MGC138218; MGC142024
• Gene ID: 1015
• mRNA Refseq: NM_001144663
• Protein Refseq: NP_001138135
• MIM: 603017
• UniProt ID: Q12864