Recombinant Human CD99L2, His-tagged

• Cat.No.: CD99L2-61H
• Product Overview: Recombinant Human CD99 Antigen-Like Protein 2/CD99L2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp26-Ala188) of Human CD99L2 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: CD99 Antigen-Like Protein 2 (CD99L2) belongs to the CD99 family. CD99L2 is a single-pass type I membrane protein and expressed in many tissues, with low expression in thymus. CD99L2 plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIG GRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVG GGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Protein length: 26-188 a.a.

Gene Information

• Gene Name: CD99L2 CD99 molecule-like 2 [ Homo sapiens ]
• Official Symbol: CD99L2
• Synonyms: CD99L2; CD99 molecule-like 2; CD99 antigen like 2 , MIC2 like 1 , MIC2L1; CD99 antigen-like protein 2; CD99B; MIC2 like 1; MIC2-like protein 1; MIC2L1; DKFZp761H2024
• Gene ID: 83692
• mRNA Refseq: NM_001184808
• Protein Refseq: NP_001171737
• MIM: 300846
• UniProt ID: Q8TCZ2
• Chromosome Location: Xq28