Recombinant Human CD97

Cat.No. : CD97-26331TH
Product Overview : Recombinant fragment of Human CD97 (aa 421-529) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 109 amino acids
Description : This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19.
Molecular Weight : 37.620kDa inclusive of tags
Tissue specificity : Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and p
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNS PILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKS DSDRGGHWATEGCQVLGSKNGSTTCQCSH
Sequence Similarities : Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.Contains 5 EGF-like domains.Contains 1 GPS domain.
Gene Name CD97 CD97 molecule [ Homo sapiens ]
Official Symbol CD97
Synonyms CD97; CD97 molecule; CD97 antigen; leukocyte antigen CD97; seven transmembrane helix receptor; seven span transmembrane protein; seven transmembrane; heterodimeric receptor associated with inflammation; TM7LN1;
Gene ID 976
mRNA Refseq NM_001025160
Protein Refseq NP_001020331
MIM 601211
Uniprot ID P48960
Chromosome Location 19p13
Pathway Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem;
Function G-protein coupled receptor activity; calcium ion binding; receptor activity; signal transducer activity; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD97 Products

Required fields are marked with *

My Review for All CD97 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon