Recombinant Human CD93 Protein, His-tagged

• Cat.No.: CD93-037H
• Product Overview: Recombinant Human CD93 Protein with His tag was expressed in E. coli.

Specification

• Description: The CD93 antigen is a 652 amino acid cell-surface glycoprotein expressed by monocytes, neutrophils, platelets, microglia, and endothelial cells. CD93 was originally thought to be a putative receptor for the complement component C1q, a serum glycoprotein which plays an integral role in the activation of the classical pathway in response to immune complexes. As a result, in the literature the CD93 gene product has also been referred to as C1QR1 and C1qRp as well as MXRA4 (matrix-remodeling-associated protein 4). Recent studies suggest that the CD93 antigen plays a role in intercellular adhesion and in clearance of apoptotic cells. CD93 is a heavily O-glycosylated, type I transmembrane protein consisting of an N-terminal domain with homology to C-type Lectin domains, a tandem array of EGF-like domains, a single transmembrane domain and a short cytoplasmic tail.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~62 kDa
• AA Sequence: ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD93 CD93 molecule [ Homo sapiens (human) ]
• Official Symbol: CD93
• Synonyms: CD93; CD93 molecule; C1QR1, CD93 antigen , complement component 1, q subcomponent, receptor 1 , matrix remodelling associated 4 , MXRA4; complement component C1q receptor; C1qR(P); C1qRP; CDw93; dJ737E23.1; ECSM3; C1qR; CD93 antigen; C1q receptor 1; C1q/MBL/SPA receptor; matrix-remodelling associated 4; matrix-remodeling-associated protein 4; complement component 1 q subcomponent receptor 1; complement component 1, q subcomponent, receptor 1; C1QR1; MXRA4
• Gene ID: 22918
• mRNA Refseq: NM_012072
• Protein Refseq: NP_036204
• MIM: 120577
• UniProt ID: Q9NPY3