Recombinant Human CD93 Protein, His-tagged
Cat.No. : | CD93-037H |
Product Overview : | Recombinant Human CD93 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The CD93 antigen is a 652 amino acid cell-surface glycoprotein expressed by monocytes, neutrophils, platelets, microglia, and endothelial cells. CD93 was originally thought to be a putative receptor for the complement component C1q, a serum glycoprotein which plays an integral role in the activation of the classical pathway in response to immune complexes. As a result, in the literature the CD93 gene product has also been referred to as C1QR1 and C1qRp as well as MXRA4 (matrix-remodeling-associated protein 4). Recent studies suggest that the CD93 antigen plays a role in intercellular adhesion and in clearance of apoptotic cells. CD93 is a heavily O-glycosylated, type I transmembrane protein consisting of an N-terminal domain with homology to C-type Lectin domains, a tandem array of EGF-like domains, a single transmembrane domain and a short cytoplasmic tail. |
Molecular Mass : | ~62 kDa |
AA Sequence : | ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD93 CD93 molecule [ Homo sapiens (human) ] |
Official Symbol | CD93 |
Synonyms | CD93; CD93 molecule; C1QR1, CD93 antigen , complement component 1, q subcomponent, receptor 1 , matrix remodelling associated 4 , MXRA4; complement component C1q receptor; C1qR(P); C1qRP; CDw93; dJ737E23.1; ECSM3; C1qR; CD93 antigen; C1q receptor 1; C1q/MBL/SPA receptor; matrix-remodelling associated 4; matrix-remodeling-associated protein 4; complement component 1 q subcomponent receptor 1; complement component 1, q subcomponent, receptor 1; C1QR1; MXRA4; |
Gene ID | 22918 |
mRNA Refseq | NM_012072 |
Protein Refseq | NP_036204 |
MIM | 120577 |
UniProt ID | Q9NPY3 |
◆ Recombinant Proteins | ||
Cd93-19M | Recombinant Mouse Cd93 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD93-1263H | Recombinant Human CD93 Protein (Glu227-Thr493), N-GST tagged | +Inquiry |
Cd93-7276M | Recombinant Mouse Cd93 Protein, His-tagged | +Inquiry |
CD93-1089R | Recombinant Rat CD93 Protein, His-tagged | +Inquiry |
CD93-3117M | Recombinant Mouse CD93 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD93-1824HCL | Recombinant Human CD93 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD93 Products
Required fields are marked with *
My Review for All CD93 Products
Required fields are marked with *
0
Inquiry Basket