Recombinant Human CD9 Protein, GST-Tagged
Cat.No. : | CD9-0882H |
Product Overview : | Human CD9 full-length ORF (NP_001760.1, 1 a.a. - 228 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011] |
Molecular Mass : | 51.8 kDa |
AA Sequence : | MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD9 CD9 molecule [ Homo sapiens ] |
Official Symbol | CD9 |
Synonyms | CD9; CD9 molecule; CD9 antigen (p24), MIC3; CD9 antigen; BA2; motility related protein 1; MRP 1; P24; TSPAN29; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN-29; FLJ99568; |
Gene ID | 928 |
mRNA Refseq | NM_001769 |
Protein Refseq | NP_001760 |
MIM | 143030 |
UniProt ID | P21926 |
◆ Recombinant Proteins | ||
CD9-178H | Recombinant Human CD9 Protein, C-His-tagged | +Inquiry |
CD9-1H | Recombinant Human CD9 Protein, His-tagged | +Inquiry |
Cd9-852M | Recombinant Mouse Cd9 Protein, MYC/DDK-tagged | +Inquiry |
RFL13226FF | Recombinant Full Length Cat Cd9 Antigen(Cd9) Protein, His-Tagged | +Inquiry |
CD9-4269H | Recombinant Human CD9 Molecule | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD9-2110HCL | Recombinant Human CD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD9 Products
Required fields are marked with *
My Review for All CD9 Products
Required fields are marked with *
0
Inquiry Basket