Recombinant Human CD79B protein, T7/His-tagged

• Cat.No.: CD79B-89H
• Product Overview: Recombinant human CD79B cDNA (29 – 159aa, derived from BC032651) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 29-159 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNV SWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLA QLKQRNTLKD
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro human CD79B mediated B cell differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD79B protein-protein interaction assay development.3. Potential biomarker protein for plasma cell myeloma.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ]
• Official Symbol: CD79B
• Synonyms: CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 prote
• Gene ID: 974
• mRNA Refseq: NM_000626
• Protein Refseq: NP_000617
• MIM: 147245
• UniProt ID: P40259
• Chromosome Location: 17q23
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem
• Function: transmembrane signaling receptor activity