Recombinant Human CD79B Protein, C-His-tagged
Cat.No. : | CD79B-209H |
Product Overview : | Recombinant Human CD79B Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The B cell antigen receptor (BCR) is composed of membrane immunoglobulin molecules non-covalently associated with the heterodimeric signaling component, CD79A and CD79B (also known as Igα and Igβ, respectively). The presence of this receptor complex is essential for B cell development and function. Following antigen binding, CD79A/CD79B heterodimers are phosphorylated and initiate intracellular signaling through Src family kinases, Lyn, Blk, and Fyn, as well as Syk and Btk tyrosine kinases. The complexity of BCR signaling results in a variety of distinct cellular functions, such as proliferation, tolerance, apoptosis, and differentiation. BCR-antigen ligation also leads to internalization of the complex, trafficking to late endosomes, and antigen presentation in major histocompatibility molecules on the B cell surface. CD79B enhances the phosphorylation of CD79A. Alternatively spliced transcript variants encoding different isoforms of CD79B have been identified. CD79B is widely expressed on B cell malignancies and may serve as a target for therapeutic intervention. |
Molecular Mass : | ~14 kDa |
AA Sequence : | ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens (human) ] |
Official Symbol | CD79B |
Synonyms | CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 protein; CD79b antigen (immunoglobulin-associated beta); IGB; AGM6; |
Gene ID | 974 |
mRNA Refseq | NM_000626 |
Protein Refseq | NP_000617 |
MIM | 147245 |
UniProt ID | P40259 |
◆ Recombinant Proteins | ||
CD79B-143H | Active Recombinant Human CD79B protein, His-tagged | +Inquiry |
Cd79b-6898M | Recombinant Mouse Cd79b(Val26-Asp158) Protein, C-Fc-tagged | +Inquiry |
Cd79b-7487R | Recombinant Rat Cd79b, Fc-tagged | +Inquiry |
CD79B-239HF | Recombinant Human CD79B Protein, hFc-tagged, FITC conjugated | +Inquiry |
CD79B-151H | Recombinant Human CD79B Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
CD79B-1323RCL | Recombinant Rat CD79B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD79B Products
Required fields are marked with *
My Review for All CD79B Products
Required fields are marked with *
0
Inquiry Basket