Recombinant Human CD79B

• Cat.No.: CD79B-27508TH
• Product Overview: Recombinant full length Human CD79b with N terminal proprietary tag; Predicted MWt 50.60 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 229 amino acids
• Description: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
• Molecular Weight: 50.600kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKG SACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQ EMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG IIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLD IDQTATYEDIVTLRTGEVKWSVGEHPGQE

Gene Information

• Gene Name: CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ]
• Official Symbol: CD79B
• Synonyms: CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29
• Gene ID: 974
• mRNA Refseq: NM_000626
• Protein Refseq: NP_000617
• MIM: 147245
• Uniprot ID: P40259
• Chromosome Location: 17q23
• Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem
• Function: transmembrane signaling receptor activity