Recombinant Human CD79A, StrepII-tagged

• Cat.No.: CD79A-240H
• Product Overview: Purified human recombinant CD79a or B-cell antigen receptor protein (amino acids 33-116, 84 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 9.5 kDa. (Accession NP_001774.1; UniProt P11912)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 33-116, 84 a.a.
• Description: This product is the extracellular domain of the CD79 alpha chain. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR), which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. It is Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCR VQEGNESYQ
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at °C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: CD79A CD79a molecule, immunoglobulin-associated alpha [ Homo sapiens ]
• Official Symbol: CD79A
• Synonyms: CD79A; CD79a molecule, immunoglobulin-associated alpha; CD79A antigen (immunoglobulin associated alpha) , IGA; B-cell antigen receptor complex-associated protein alpha chain; MB 1; ig-alpha; MB-1 membrane glycoprotein; surface IgM-associated protein; CD79a antigen (immunoglobulin-associated alpha); membrane-bound immunoglobulin-associated protein; IGA; MB-1
• Gene ID: 973
• mRNA Refseq: NM_001783
• Protein Refseq: NP_001774
• MIM: 112205
• UniProt ID: P11912
• Chromosome Location: 19q13.2
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Immune System, organism-specific biosystem
• Function: transmembrane signaling receptor activity