Recombinant Human CD7 Protein, GST-Tagged

Cat.No. : CD7-0847H
Product Overview : Human CD7 full-length ORF (AAH09293, 21 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
Availability April 19, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq, Jul 2008]
Molecular Mass : 49.94 kDa
AA Sequence : PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD7 CD7 molecule [ Homo sapiens ]
Official Symbol CD7
Synonyms CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; T-cell leukemia antigen; T-cell surface antigen Leu-9; LEU-9;
Gene ID 924
mRNA Refseq NM_006137
Protein Refseq NP_006128
MIM 186820
UniProt ID P09564

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD7 Products

Required fields are marked with *

My Review for All CD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon