Recombinant Human CD68, StrepII-tagged

• Cat.No.: CD68-239H
• Product Overview: Purified human recombinant CD68 or Macrosialin protein (amino acids 22-319, 298 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 31.5 kDa. (Accession NP_001242.2; UniProt P34810)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 22-319, 298 a.a.
• Description: This product is the extracellular domain of CD68. CD68 is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATT SHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPH LLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSC PSDRS
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: CD68 CD68 molecule [ Homo sapiens ]
• Official Symbol: CD68
• Synonyms: CD68; CD68 molecule; CD68 antigen; macrosialin; DKFZp686M18236; GP110; LAMP4; macrophage antigen CD68; SCARD1; scavenger receptor class D; member 1; scavenger receptor class D, member 1
• Gene ID: 968
• mRNA Refseq: NM_001040059
• Protein Refseq: NP_001035148
• MIM: 153634
• UniProt ID: P34810
• Chromosome Location: 17p13
• Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem