Recombinant Human CD68, StrepII-tagged

Cat.No. : CD68-239H
Product Overview : Purified human recombinant CD68 or Macrosialin protein (amino acids 22-319, 298 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 31.5 kDa. (Accession NP_001242.2; UniProt P34810)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 22-319, 298 a.a.
Description : This product is the extracellular domain of CD68. CD68 is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
AA Sequence : NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATT SHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPH LLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSC PSDRS
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name CD68 CD68 molecule [ Homo sapiens ]
Official Symbol CD68
Synonyms CD68; CD68 molecule; CD68 antigen; macrosialin; DKFZp686M18236; GP110; LAMP4; macrophage antigen CD68; SCARD1; scavenger receptor class D; member 1; scavenger receptor class D, member 1;
Gene ID 968
mRNA Refseq NM_001040059
Protein Refseq NP_001035148
MIM 153634
UniProt ID P34810
Chromosome Location 17p13
Pathway Lysosome, organism-specific biosystem; Lysosome, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD68 Products

Required fields are marked with *

My Review for All CD68 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon