Recombinant Human CD68 Protein, C-His-tagged

• Cat.No.: CD68-204H
• Product Overview: Recombinant Human CD68 Protein with C-His tag was expressed in E. coli.

Specification

• Description: CD68 (macrosialin) is a heavily glycosylated transmembrane protein that is expressed by and commonly used as a marker for monocytes and macrophages. It is found on the plasma membrane, as well as endosomal and lysosomal membranes. It is proposed to bind OxLDL and has been observed as a homodimer.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~33 kDa
• AA Sequence: NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD68 CD68 molecule [ Homo sapiens (human) ]
• Official Symbol: CD68
• Synonyms: CD68; CD68 molecule; CD68 antigen; macrosialin; DKFZp686M18236; GP110; LAMP4; macrophage antigen CD68; SCARD1; scavenger receptor class D; member 1; scavenger receptor class D, member 1
• Gene ID: 968
• mRNA Refseq: NM_001040059
• Protein Refseq: NP_001035148
• MIM: 153634
• UniProt ID: P34810