Recombinant Human CD68 Protein, C-His-tagged

Cat.No. : CD68-204H
Product Overview : Recombinant Human CD68 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CD68 (macrosialin) is a heavily glycosylated transmembrane protein that is expressed by and commonly used as a marker for monocytes and macrophages. It is found on the plasma membrane, as well as endosomal and lysosomal membranes. It is proposed to bind OxLDL and has been observed as a homodimer.
Molecular Mass : ~33 kDa
AA Sequence : NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD68 CD68 molecule [ Homo sapiens (human) ]
Official Symbol CD68
Synonyms CD68; CD68 molecule; CD68 antigen; macrosialin; DKFZp686M18236; GP110; LAMP4; macrophage antigen CD68; SCARD1; scavenger receptor class D; member 1; scavenger receptor class D, member 1;
Gene ID 968
mRNA Refseq NM_001040059
Protein Refseq NP_001035148
MIM 153634
UniProt ID P34810

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD68 Products

Required fields are marked with *

My Review for All CD68 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon