Recombinant Human CD5L protein, T7/His-tagged

• Cat.No.: CD5L-74H
• Product Overview: Recombinant human CD5L cDNA (20 – 347 aa, derived from BC033586) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 20-347 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFSPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAVLCREL GCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL ADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSGREATL QDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQVVCKQLGCGKS LSPSFRDRKCYGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro non-glycosylated CD5L protein mediated lipolytic pathway regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for CD5L protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. Potential diagnostic and therapeutic target protein for controlling obesity disease.5. May be used for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: CD5L CD5 molecule-like [ Homo sapiens ]
• Official Symbol: CD5L
• Synonyms: CD5L; CD5 molecule-like; API6, apoptosis inhibitor 6 , CD5 antigen like (scavenger receptor cysteine rich family); CD5 antigen-like; Spalpha; CT-2; apoptosis inhibitor 6; igM-associated peptide; CD5 antigen-like (scavenger receptor cysteine rich family)
• Gene ID: 922
• mRNA Refseq: NM_005894
• Protein Refseq: NP_005885
• MIM: 602592
• UniProt ID: O43866
• Chromosome Location: 1q21-q23
• Function: scavenger receptor activity