Recombinant Human CD59 protein, GST-tagged

• Cat.No.: CD59-2667H
• Product Overview: Recombinant Human CD59 protein(P13987)(26-102aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36 kDa
• Protein length: 26-102aa
• AA Sequence: LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CD59 CD59 molecule, complement regulatory protein [ Homo sapiens ]
• Official Symbol: CD59
• Synonyms: CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) , CD59 antigen, complement regulatory protein , MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16.3A5; EJ16; EJ30; EL32; G344; p18 20; protectin; 1F5 antigen; MEM43 antigen; Ly-6-like protein; T cell-activating protein; human leukocyte antigen MIC11; lymphocytic antigen CD59/MEM43; 20 kDa homologous restriction factor; membrane inhibitor of reactive lysis; membrane attack complex inhibition factor; membrane attack complex (MAC) inhibition factor; surface anitgen recognized by monoclonal 16.3A5; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); 1F5; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; HRF-20; MAC-IP; p18-20; MGC2354; FLJ38134; FLJ92039
• Gene ID: 966
• mRNA Refseq: NM_000611
• Protein Refseq: NP_000602
• MIM: 107271
• UniProt ID: P13987