Recombinant Human CD47 Protein, His-Flag-StrepII-Tagged

• Cat.No.: CD47-0826H
• Product Overview: Purified CD47 (NP_001768.1, 19 a.a. - 141 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Specification

• Species: Human
• Source: Human Cells
• Tag: Flag&His&Strep II
• Protein Length: 19-141 a.a.
• Description: This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]
• Form: Liquid
• Bio-activity: Not Tested
• Molecular Mass: 16.61 kDa
• AA Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: ≥ 10 μg/mL
• Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.

Gene Information

• Gene Name: CD47 CD47 molecule [ Homo sapiens ]
• Official Symbol: CD47
• Synonyms: CD47; CD47 molecule; CD47 antigen (Rh related antigen, integrin associated signal transducer), MER6; leukocyte surface antigen CD47; antigen identified by monoclonal 1D8; antigenic surface determinant protein OA3; CD47 glycoprotein; IAP; integrin associated protein; OA3; Rh related antigen; Rh-related antigen; integrin-associated protein; integrin-associated signal transducer; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); MER6
• Gene ID: 961
• mRNA Refseq: NM_001777
• Protein Refseq: NP_001768
• MIM: 601028
• UniProt ID: Q08722