Recombinant Human CD47 Protein, His-Flag-StrepII-Tagged

Cat.No. : CD47-0826H
Product Overview : Purified CD47 (NP_001768.1, 19 a.a. - 141 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Flag&His&Strep II
Protein Length : 19-141 a.a.
Description : This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]
Form : Liquid
Bio-activity : Not Tested
Molecular Mass : 16.61 kDa
AA Sequence : QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : ≥ 10 μg/mL
Storage Buffer : 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Gene Name CD47 CD47 molecule [ Homo sapiens ]
Official Symbol CD47
Synonyms CD47; CD47 molecule; CD47 antigen (Rh related antigen, integrin associated signal transducer), MER6; leukocyte surface antigen CD47; antigen identified by monoclonal 1D8; antigenic surface determinant protein OA3; CD47 glycoprotein; IAP; integrin associated protein; OA3; Rh related antigen; Rh-related antigen; integrin-associated protein; integrin-associated signal transducer; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); MER6;
Gene ID 961
mRNA Refseq NM_001777
Protein Refseq NP_001768
MIM 601028
UniProt ID Q08722

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD47 Products

Required fields are marked with *

My Review for All CD47 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon