Recombinant Human CD44 protein, GST-tagged

Cat.No. : CD44-589H
Product Overview : Recombinant Human CD44(28-380aa) fused with GST tag at N-terminal was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 28-380aa
Description : The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
AA Sequence : CRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNT GVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDD VSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATSTSSNTISAGWEPNEENEDERDRHLSFSGS GIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHH EHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPREDSHST
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Storage : Short-term storage: Store at 2-8 centigrade for two weeks. Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for Reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When Reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name CD44 CD44 molecule (Indian blood group) [ Homo sapiens ]
Official Symbol CD44
Synonyms CD44; CD44 molecule (Indian blood group); CD44 antigen (homing function and Indian blood group system) , MDU2, MDU3, MIC4; CD44 antigen; CD44R; chondroitin sulfate proteoglycan 8; CSPG8; HCELL; hematopoietic cell E and L selectin ligand; IN; MC56; Pgp1; epican; Hermes antigen; hyaluronate receptor; phagocytic glycoprotein 1; heparan sulfate proteoglycan; cell surface glycoprotein CD44; extracellular matrix receptor III; GP90 lymphocyte homing/adhesion receptor; hematopoietic cell E- and L-selectin ligand; homing function and Indian blood group system; LHR; MDU2; MDU3; MIC4; CDW44; HUTCH-I; ECMR-III; MGC10468;
Gene ID 960
mRNA Refseq NM_000610
Protein Refseq NP_000601
MIM 107269
UniProt ID P16070
Chromosome Location 11p13
Pathway Cytokine Signaling in Immune system, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem;
Function binding; collagen binding; hyaluronic acid binding; hyaluronic acid binding; hyaluronic acid binding; hyalurononglucosaminidase activity; protein binding; receptor activity; contributes_to transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD44 Products

Required fields are marked with *

My Review for All CD44 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon