Recombinant Human CD40 Protein, C-His-tagged
Cat.No. : | CD40-195H |
Product Overview : | Recombinant Human CD40 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD40, also known as tumor necrosis factor receptor superfamily member 5 (TNFRSF5), is a type I transmembrane protein expressed on the surface of B cells and professional antigen-presenting cells of the immune system, as well as on several non-hematopoietic cell types and cancers. CD40 interacts with CD40 ligand (CD40L/TNFSF5), which is expressed primarily on activated T cells but has also been reported on blood platelets, mast cells, basophils, NK cells, and B cells. Upon engagement with CD40L, CD40 signals through TNF receptor associated factors and MAP kinase signaling pathways, resulting in a wide variety of immune and inflammatory responses, including dendritic cell activation and cross-presentation, T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. The CD40/CD40L axis is essential for the initiation and progression of cellular and humoral adaptive immunity, and is an important area of interest in the study of tumor immunology, neurodegenerative diseases, vascular diseases, and inflammatory disorders. |
Molecular Mass : | ~19 kDa |
AA Sequence : | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD40 CD40 molecule, TNF receptor superfamily member 5 [ Homo sapiens (human) ] |
Official Symbol | CD40 |
Synonyms | CD40; CD40 molecule, TNF receptor superfamily member 5; TNFRSF5, tumor necrosis factor receptor superfamily, member 5; tumor necrosis factor receptor superfamily member 5; Bp50; p50; CD40L receptor; CD40 type II isoform; B cell-associated molecule; B cell surface antigen CD40; B-cell surface antigen CD40; CD40 antigen (TNF receptor superfamily member 5); tumor necrosis factor receptor superfamily, member 5; nerve growth factor receptor-related B-lymphocyte activation molecule; CDW40; TNFRSF5; MGC9013; |
Gene ID | 958 |
mRNA Refseq | NM_001250 |
Protein Refseq | NP_001241 |
MIM | 109535 |
UniProt ID | P25942 |
◆ Recombinant Proteins | ||
CD40-165CAF555 | Recombinant Canine CD40 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Cd40-8726RAF488 | Recombinant Rat Cd40 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD40-3225M | Recombinant Mouse CD40 protein(Met1-Arg193), rFc-tagged | +Inquiry |
Cd40-8726RF | Recombinant Rat Cd40 Protein, Fc-tagged, FITC conjugated | +Inquiry |
CD40-174HAF488 | Recombinant Human CD40 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40-1831MCL | Recombinant Mouse CD40 cell lysate | +Inquiry |
CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
CD40-001CCL | Recombinant Canine CD40 cell lysate | +Inquiry |
CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
CD40-2617HCL | Recombinant Human CD40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD40 Products
Required fields are marked with *
My Review for All CD40 Products
Required fields are marked with *
0
Inquiry Basket