Recombinant Human CD40, Fc-tagged
Cat.No. : | CD40-27810TH |
Product Overview : | Recombinant full length Human CD40 fused to the Fc region of Human IgG1 expressed in modified Human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
Conjugation : | Fc |
Tissue specificity : | B-cells and in primary carcinomas. |
Biological activity : | Activity:The ED50 of CD40-27810TH is typically 1.0-1.5 ug/ml as measured by its ability to neutralize CD40 ligand mediated proliferation of T47-D cells. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:EPPTACREKQYLINSQCCSLCQPGQKLVS DCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNL GLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSC SPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWT SCETKDLVVQQAGTNKTDVVCGPQDRLRRSSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K |
Sequence Similarities : | Contains 4 TNFR-Cys repeats. |
Full Length : | Full L. |
Gene Name | CD40 CD40 molecule, TNF receptor superfamily member 5 [ Homo sapiens ] |
Official Symbol | CD40 |
Synonyms | CD40; CD40 molecule, TNF receptor superfamily member 5; TNFRSF5, tumor necrosis factor receptor superfamily, member 5; tumor necrosis factor receptor superfamily member 5; Bp50; p50; |
Gene ID | 958 |
mRNA Refseq | NM_001250 |
Protein Refseq | NP_001241 |
MIM | 109535 |
Uniprot ID | P25942 |
Chromosome Location | 20q12-q13.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Asthma, organism-specific biosystem; Asthma, conserved biosystem; |
Function | enzyme binding; protein binding; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
Cd40-1462M | Recombinant Mouse Cd40 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD40-422P | Recombinant Pig CD40 protein, His-tagged | +Inquiry |
Cd40-6892MAF488 | Recombinant Mouse Cd40 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Cd40-6892M | Recombinant Mouse Cd40, Fc-His tagged | +Inquiry |
CD40-174H | Recombinant Human CD40, Fc-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40-001CCL | Recombinant Canine CD40 cell lysate | +Inquiry |
CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
CD40-1831MCL | Recombinant Mouse CD40 cell lysate | +Inquiry |
CD40-2617HCL | Recombinant Human CD40 cell lysate | +Inquiry |
CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD40 Products
Required fields are marked with *
My Review for All CD40 Products
Required fields are marked with *
0
Inquiry Basket