Recombinant Human CD4, StrepII-tagged
Cat.No. : | CD4-234H |
Product Overview : | Purified human recombinant T-cell surface glycoprotein CD4 protein (amino acids 26-396, 371 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 41.3 kDa. (Accession NP_000607.1; UniProt P01730) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 26-396, 371 a.a. |
Description : | This product is the extracellular domain of CD4, a membrane glycoprotein of T lymphocytes that interacts with major histocompatibility complex class II antigens and is also a receptor for the human immunodeficiency virus. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLK IEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLE LQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKS WITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKN LTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQP |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | CD4 CD4 molecule [ Homo sapiens ] |
Official Symbol | CD4 |
Synonyms | CD4; CD4 molecule; CD4 antigen (p55) , T cell surface glycoprotein CD4; T-cell surface glycoprotein CD4; CD4 receptor; CD4 antigen (p55); T-cell surface antigen T4/Leu-3; CD4mut; |
Gene ID | 920 |
mRNA Refseq | NM_000616 |
Protein Refseq | NP_000607 |
MIM | 186940 |
UniProt ID | P01730 |
Chromosome Location | 12p13.31 |
Pathway | Adaptive Immune System, organism-specific biosystem; Alpha-defensins, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Arf1 pathway, organism-specific biosystem; Binding and entry of HIV virion, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; |
Function | MHC class II protein binding; coreceptor activity; enzyme binding; extracellular matrix structural constituent; glycoprotein binding; protein binding; protein homodimerization activity; protein kinase binding; receptor activity; transmembrane signaling receptor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
CD4-172H | Recombinant Human CD4 Protein, C-His-tagged | +Inquiry |
CD4-321M | Recombinant Mouse CD4 protein, Fc-tagged | +Inquiry |
CD4-39H | Active Recombinant human CD4 protein (26-390aa), C-hIgG/His-tagged | +Inquiry |
CD4-151H | Recombinant Human CD4 Protein, DYKDDDDK-tagged | +Inquiry |
CD4-327H | Active Recombinant Human CD4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD4-1865FCL | Recombinant Ferret CD4 cell lysate | +Inquiry |
CD4-1905HCL | Recombinant Human CD4 cell lysate | +Inquiry |
CD4-2580MCL | Recombinant Mouse CD4 cell lysate | +Inquiry |
CD4-947CCL | Recombinant Cynomolgus CD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD4 Products
Required fields are marked with *
My Review for All CD4 Products
Required fields are marked with *
0
Inquiry Basket