Recombinant Human CD4, StrepII-tagged

• Cat.No.: CD4-234H
• Product Overview: Purified human recombinant T-cell surface glycoprotein CD4 protein (amino acids 26-396, 371 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 41.3 kDa. (Accession NP_000607.1; UniProt P01730)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 26-396, 371 a.a.
• Description: This product is the extracellular domain of CD4, a membrane glycoprotein of T lymphocytes that interacts with major histocompatibility complex class II antigens and is also a receptor for the human immunodeficiency virus.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLK IEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLE LQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKS WITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKN LTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQP
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: CD4 CD4 molecule [ Homo sapiens ]
• Official Symbol: CD4
• Synonyms: CD4; CD4 molecule; CD4 antigen (p55) , T cell surface glycoprotein CD4; T-cell surface glycoprotein CD4; CD4 receptor; CD4 antigen (p55); T-cell surface antigen T4/Leu-3; CD4mut
• Gene ID: 920
• mRNA Refseq: NM_000616
• Protein Refseq: NP_000607
• MIM: 186940
• UniProt ID: P01730
• Chromosome Location: 12p13.31
• Pathway: Adaptive Immune System, organism-specific biosystem; Alpha-defensins, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Arf1 pathway, organism-specific biosystem; Binding and entry of HIV virion, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem
• Function: MHC class II protein binding; coreceptor activity; enzyme binding; extracellular matrix structural constituent; glycoprotein binding; protein binding; protein homodimerization activity; protein kinase binding; receptor activity; transmembrane signaling receptor activity; zinc ion binding