Recombinant Human CD38
Cat.No. : | CD38-27749TH |
Product Overview : | Recombinant full length Human CD38 with a N terminal proprietary tag: predicted molecular weight 59.11 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 300 amino acids |
Description : | CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling. |
Molecular Weight : | 59.110kDa inclusive of tags |
Tissue specificity : | Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLA VVVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHV DCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWC GEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR PDKFLQCVKNPEDSSCTSEI |
Sequence Similarities : | Belongs to the ADP-ribosyl cyclase family. |
Gene Name | CD38 CD38 molecule [ Homo sapiens ] |
Official Symbol | CD38 |
Synonyms | CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase; |
Gene ID | 952 |
mRNA Refseq | NM_001775 |
Protein Refseq | NP_001766 |
MIM | 107270 |
Uniprot ID | P28907 |
Chromosome Location | 4p15.32 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | NAD+ nucleosidase activity; hydrolase activity, acting on glycosyl bonds; nucleotide binding; phosphorus-oxygen lyase activity; receptor activity; |
◆ Recombinant Proteins | ||
CD38-1185CF | Recombinant Monkey CD38 Protein, Fc-tagged, FITC conjugated | +Inquiry |
CD38-1334M | Recombinant Mouse CD38 protein(Leu45-Thr304) | +Inquiry |
CD38-563R | Recombinant Rhesus Macaque CD38 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD38-443H | Recombinant Human CD38 Protein (Va43-Ile300), His-tagged, Biotinylated | +Inquiry |
Cd38-7616R | Recombinant Rat Cd38 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD38-1259RCL | Recombinant Rat CD38 cell lysate | +Inquiry |
CD38-2639MCL | Recombinant Mouse CD38 cell lysate | +Inquiry |
CD38-1025RCL | Recombinant Rabbit CD38 cell lysate | +Inquiry |
CD38-1557HCL | Recombinant Human CD38 cell lysate | +Inquiry |
CD38-1398CCL | Recombinant Cynomolgus CD38 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD38 Products
Required fields are marked with *
My Review for All CD38 Products
Required fields are marked with *
0
Inquiry Basket