Recombinant Human CD37 Protein, C-His-tagged

• Cat.No.: CD37-193H
• Product Overview: Recombinant Human CD37 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Tetra-spans transmembrane family (TSTF) members (CD9, CD37, CD53, CD63, CD81 and CD82) are cell-surface proteins that are characterized by the presence of four hydrophobic, membrane-spanning domains. TSTF members can mediate signal transduction events influencing the regulation of cell development, adhesion, activation, growth and motility. The human CD37 gene maps to chromosome 19p13.3 and encodes a 281 amino acid protein. CD37 is a cell surface glycoprotein that can complex with integrins and other TSTF proteins and may play a role in T cell-B cell interactions. CD37 is strongly expressed on normal and neoplastic mature sIg+ B cells and is detected at low levels on resting and activated T cells, neutrophils, granulocytes and monocytes. Transgenic mouse models elicit no changes in development and cellular composition of lymphoid organs where CD37 is lacking.
• Molecular Mass: ~14 kDa
• AA Sequence: RAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD37 CD37 molecule [ Homo sapiens (human) ]
• Official Symbol: CD37
• Synonyms: CD37; CD37 molecule; CD37 antigen; leukocyte antigen CD37; TSPAN26; tspan-26; tetraspanin-26; leukocyte surface antigen CD37; cell differentiation antigen 37; GP52-40; MGC120234
• Gene ID: 951
• mRNA Refseq: NM_001040031
• Protein Refseq: NP_001035120
• MIM: 151523
• UniProt ID: P11049