Recombinant Human CD33 Protein, His-tagged

Cat.No. : CD33-190H
Product Overview : Recombinant Human CD33 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : CD33, a type I transmembrane protein, is a sialic acid-binding Ig-like lectin (Siglec-3) of the Ig superfamily, and human CD33 binds preferentially to alpha-2, 6-linked sialic acid. Upon binding to its ligands CD33 transduces an inhibitory signaling through the immunoreceptor tyrosine-based inhibitory motif (ITIM) in its intracellular domain, inhibiting cellular function such as phagocytosis. In addition, CD33 is also involved in other processes, such as adhesion. Due to its exclusive expression on hematopoietic cells, particularly the myeloid lineage and their progenitors, CD33 has been actively pursued as a therapeutic target against acute myeloid leukemia (AML). CD33 may also be involved in Alzheimer’s Disease.
Molecular Mass : ~33 kDa
AA Sequence : DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CD33 CD33 molecule [ Homo sapiens (human) ]
Official Symbol CD33
Synonyms CD33; CD33 molecule; CD33 antigen (gp67); myeloid cell surface antigen CD33; FLJ00391; p67; sialic acid binding Ig like lectin 3; SIGLEC 3; SIGLEC3; gp67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC-3;
Gene ID 945
mRNA Refseq NM_001082618
Protein Refseq NP_001076087
MIM 159590
UniProt ID P20138

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD33 Products

Required fields are marked with *

My Review for All CD33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon