Recombinant Human CD302 Protein, C-His-tagged
Cat.No. : | CD302-212H |
Product Overview : | Recombinant Human CD302 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD302,potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration. |
Molecular Mass : | ~17 kDa |
AA Sequence : | DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD302 CD302 molecule [ Homo sapiens (human) ] |
Official Symbol | CD302 |
Synonyms | DCL1; DCL-1; BIMLEC; CLEC13A |
Gene ID | 9936 |
mRNA Refseq | NM_014880 |
Protein Refseq | NP_055695 |
MIM | 612246 |
UniProt ID | Q8IX05 |
◆ Recombinant Proteins | ||
CD302-3055H | Recombinant Human CD302 Protein, MYC/DDK-tagged | +Inquiry |
CD302-5379H | Recombinant Human CD302 Protein (Met1-His168), C-His tagged | +Inquiry |
CD302-3079M | Recombinant Mouse CD302 Protein | +Inquiry |
CD302-891M | Recombinant Mouse CD302 Protein, His-tagged | +Inquiry |
CD302-1699R | Recombinant Rhesus Monkey CD302 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD302-1747MCL | Recombinant Mouse CD302 cell lysate | +Inquiry |
CD302-1172RCL | Recombinant Rat CD302 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD302 Products
Required fields are marked with *
My Review for All CD302 Products
Required fields are marked with *
0
Inquiry Basket