Recombinant Human CD302 Protein, C-His-tagged
| Cat.No. : | CD302-212H |
| Product Overview : | Recombinant Human CD302 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | CD302，potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration. |
| Source : | E. coli |
| Species : | Human |
| Tag : | His |
| Molecular Mass : | ~17 kDa |
| AA Sequence : | DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | CD302 CD302 molecule [ Homo sapiens (human) ] |
| Official Symbol | CD302 |
| Synonyms | DCL1; DCL-1; BIMLEC; CLEC13A |
| Gene ID | 9936 |
| mRNA Refseq | NM_014880 |
| Protein Refseq | NP_055695 |
| MIM | 612246 |
| UniProt ID | Q8IX05 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD302 Products
Required fields are marked with *
My Review for All CD302 Products
Required fields are marked with *
0
Inquiry Basket
