Recombinant Human CD28 Protein, His-Flag-StrepII-Tagged

• Cat.No.: CD28-0773H
• Product Overview: Purified CD28 (NP_006130.1, 18 a.a. - 152 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Specification

• Species: Human
• Source: Human Cells
• Tag: Flag&His&Strep II
• Protein Length: 18-152 a.a.
• Description: The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]
• Form: Liquid
• Bio-activity: Not Tested
• Molecular Mass: 20.13 kDa
• AA Sequence: GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
• Applications: Western Blot
  Enzyme-linked Immunoabsorbent Assay
  SDS-PAGE
  Protein Interaction
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: ≥ 10 μg/mL
• Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.

Gene Information

• Gene Name: CD28 CD28 molecule [ Homo sapiens ]
• Official Symbol: CD28
• Synonyms: CD28; CD28 molecule; CD28 antigen (Tp44); T-cell-specific surface glycoprotein CD28; T cell specific surface glycoprotein; CD28 antigen; Tp44; MGC138290
• Gene ID: 940
• mRNA Refseq: NM_001243077
• Protein Refseq: NP_001230006
• MIM: 186760
• UniProt ID: P10747