Recombinant Human CD209 protein, Fc-tagged

• Cat.No.: CD209-634H
• Product Overview: Recombinant Human CD209(Lys62-Ala404) fused with Fc tag at N-terminal was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: Fc
• Form: Lyophilized from a 0.2 μM filtered solution of PBS, pH7.4
• Protein length: Lys62-Ala404
• AA Sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEK SKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVER LCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWM GLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSA ASCSRDEEQFLSPAPATPNPPPA
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: CD209 CD209 molecule [ Homo sapiens ]
• Official Symbol: CD209
• Synonyms: CD209; CD209 molecule; CD209 antigen; CDSIGN; CLEC4L; DC SIGN; DC SIGN1; HIV gpl20-binding protein; C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin; DC-SIGN; DC-SIGN1; MGC129965
• Gene ID: 30835
• mRNA Refseq: NM_001144893
• Protein Refseq: NP_001138365
• MIM: 604672
• UniProt ID: Q9NNX6
• Chromosome Location: 19p13
• Pathway: Measles, organism-specific biosystem; Measles, conserved biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem
• Function: mannose binding; metal ion binding; peptide antigen binding; receptor activity; sugar binding; virion binding