Recombinant Human CD200 protein, His-SUMO&Myc-tagged

• Cat.No.: CD200-366H
• Product Overview: Recombinant Human CD200 protein(P41217)(31-232aa), fused with N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-SUMO&C-Myc
• Protein length: 31-232aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.4 kDa
• AASequence: QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CD200 CD200 molecule [ Homo sapiens ]
• Official Symbol: CD200
• Synonyms: CD200; CD200 molecule; antigen identified by monoclonal MRC OX 2 , CD200 antigen , MOX1, MOX2; OX-2 membrane glycoprotein; MRC; OX 2; CD200 antigen; MRC OX-2 antigen; antigen identified by monoclonal MRC OX-2; MOX1; MOX2; OX-2
• Gene ID: 4345
• mRNA Refseq: NM_001004196
• Protein Refseq: NP_001004196
• MIM: 155970
• UniProt ID: P41217