Recombinant Human CD177 protein, T7/His-tagged

• Cat.No.: CD177-63H
• Product Overview: Recombinant human CD177 (NTN4) gene (22 - 408 aa) fused with T7/His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 22-408 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFELLLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESG PQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSME GCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGT TIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASY THFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATHCYDGYIHLSGGGLST KMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGG
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein can be used as coating matrix protein for study human neutrophil-endothelia cell interaction study in vitro.2. As highly purified recombinant antigen, it may be used as culture matrix protein for differentiation of human endothelial cell in vitro.
• Storage: Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: CD177 CD177 molecule [ Homo sapiens ]
• Official Symbol: CD177
• Synonyms: CD177; CD177 molecule; CD177 antigen; HNA2A; NB1; polycythemia rubra vera 1; PRV1; NB1 glycoprotein; cell surface receptor; human neutrophil alloantigen 2a; polycythemia rubra vera protein 1; PRV-1; HNA-2a; NB1 GP
• Gene ID: 57126
• mRNA Refseq: NM_020406
• Protein Refseq: NP_065139
• MIM: 162860
• UniProt ID: Q8N6Q3
• Chromosome Location: 19q13.2
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem