Recombinant Human CD164 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CD164-5140H
• Product Overview: CD164 MS Standard C13 and N15-labeled recombinant protein (NP_006007) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing.
• Molecular Mass: 20.9 kDa
• AA Sequence: MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CD164 CD164 molecule [ Homo sapiens (human) ]
• Official Symbol: CD164
• Synonyms: CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn
• Gene ID: 8763
• mRNA Refseq: NM_006016
• Protein Refseq: NP_006007
• MIM: 603356
• UniProt ID: Q04900