Recombinant Human CD164 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CD164-5140H
Product Overview : CD164 MS Standard C13 and N15-labeled recombinant protein (NP_006007) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing.
Molecular Mass : 20.9 kDa
AA Sequence : MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CD164 CD164 molecule [ Homo sapiens (human) ]
Official Symbol CD164
Synonyms CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn;
Gene ID 8763
mRNA Refseq NM_006016
Protein Refseq NP_006007
MIM 603356
UniProt ID Q04900

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD164 Products

Required fields are marked with *

My Review for All CD164 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon