Recombinant Human CD14, His-tagged

• Cat.No.: CD14-28H
• Product Overview: CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Specification

• Description: The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein.
• Source: HEK293 cells.
• Species: Human
• Tag: His
• Form: Sterile Filtered White lyophilized (freeze-dried) powder. CD14 was lyophilized from a 0.2 μM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.
• AA Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRL TVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAAL AAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELP EVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH
• Purity: Greater than 95% as determined by SDS-PAGE.
• Stability: Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
• Reconstitution: It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
• Protein length: 20-352 a.a.

Gene Information

• Gene Name: CD14 CD14 molecule [ Homo sapiens (human) ]
• Official Symbol: CD14
• Synonyms: CD14; CD14 molecule; CD14 antigen; monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein
• Gene ID: 929
• mRNA Refseq: NM_000591
• Protein Refseq: NP_000582
• MIM: 158120
• UniProt ID: P08571
• Chromosome Location: 5q31.1
• Pathway: Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon; Hematopoietic cell lineage; IKK complex recruitment mediated by RIP1
• Function: lipopolysaccharide binding; lipoteichoic acid binding; peptidoglycan receptor activity