Recombinant Human CD14, His-tagged
Cat.No. : | CD14-28H |
Product Overview : | CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-352 a.a. |
Description : | The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. CD14 was lyophilized from a 0.2 μM filtered solution of 20mM PB and 150mM NaCl, PH 7.4. |
AA Sequence : | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRL TVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLK PGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAAL AAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELP EVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Stability : | Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
Reconstitution : | It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions. |
Gene Name | CD14 CD14 molecule [ Homo sapiens (human) ] |
Official Symbol | CD14 |
Synonyms | CD14; CD14 molecule; CD14 antigen; monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein |
Gene ID | 929 |
mRNA Refseq | NM_000591 |
Protein Refseq | NP_000582 |
MIM | 158120 |
UniProt ID | P08571 |
Chromosome Location | 5q31.1 |
Pathway | Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon; Hematopoietic cell lineage; IKK complex recruitment mediated by RIP1 |
Function | lipopolysaccharide binding; lipoteichoic acid binding; peptidoglycan receptor activity |
◆ Recombinant Proteins | ||
CD14-157H | Recombinant Human CD14 Protein, Fc-tagged | +Inquiry |
CD14-5309H | Recombinant Human CD14 Protein (Met1-Ala83), C-His tagged | +Inquiry |
Cd14-117M | Active Recombinant Mouse Cd14 Protein, Fc-tagged | +Inquiry |
CD14-613H | Recombinant Human CD14 protein, hFc-tagged | +Inquiry |
CD14-284H | Active Recombinant Human CD14 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD14-1469RCL | Recombinant Rat CD14 cell lysate | +Inquiry |
CD14-1604HCL | Recombinant Human CD14 cell lysate | +Inquiry |
CD14-1169CCL | Recombinant Cynomolgus CD14 cell lysate | +Inquiry |
CD14-2581MCL | Recombinant Mouse CD14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD14 Products
Required fields are marked with *
My Review for All CD14 Products
Required fields are marked with *
0
Inquiry Basket