Recombinant Human CCR5 Protein

• Cat.No.: CCR5-0693H
• Product Overview: Human CCR5 full-length ORF (XP_001125981.1) recombinant protein without tag.

Specification

• Description: This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. An allelic polymorphism in this gene results in both functional and non-functional alleles; the reference genome represents the functional allele. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2015]
• Source: Wheat Germ
• Species: Human
• Form: Liquid
• Molecular Mass: 40.5 kDa
• AA Sequence: MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Tag: Non

Gene Information

• Gene Name: CCR5 chemokine (C-C motif) receptor 5 (gene/pseudogene) [ Homo sapiens ]
• Official Symbol: CCR5
• Synonyms: CCR5; chemokine (C-C motif) receptor 5 (gene/pseudogene); chemokine (C C motif) receptor 5, CMKBR5; C-C chemokine receptor type 5; CC CKR 5; CD195; CKR 5; CKR5; IDDM22; chemr13; HIV-1 fusion coreceptor; chemokine receptor CCR5; C-C motif chemokine receptor 5 A159A; CCR-5; CKR-5; CCCKR5; CMKBR5; CC-CKR-5; FLJ78003
• Gene ID: 1234
• mRNA Refseq: NM_000579
• Protein Refseq: NP_000570
• MIM: 601373
• UniProt ID: P51681