Recombinant Human CCNQ Protein, GST-tagged

• Cat.No.: CCNQ-3782H
• Product Overview: Human FAM58A full-length ORF ( NP_689487.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Mutations in this gene have been shown to cause an X-linked dominant STAR syndrome that typically manifests syndactyly, telecanthus and anogenital and renal malformations. The protein encoded by this gene contains a cyclin-box-fold domain which suggests it may have a role in controlling nuclear cell division cycles. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008]
• Molecular Mass: 51.3 kDa
• AA Sequence: MEAGVKLGMRSIPIATACTIYHKFFCETNLDAYDPYLIAMSSIYLAGKVEEQHLRTRDIINVSNRYFNPSGEPLELDSRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLVSLQNWLNRHSWQRTPVAVTAWALLRDSYHGALCLRFQAQHIAVAVLYLALQVYGVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQIYTMDTEIP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCNQ cyclin Q [ Homo sapiens (human) ]
• Official Symbol: CCNQ
• Synonyms: CCNQ; cyclin Q; Family With Sequence Similarity 58 Member A; CDK10-Activating Cyclin; Cyclin Q; Family With Sequence Similarity 58, Member A; Cyclin-Related Protein FAM58A; Cyclin M; Cyclin-M; STAR; cyclin-related protein FAM58A; CDK10-activating cyclin; cyclin M; family with sequence similarity 58 member A
• Gene ID: 92002
• mRNA Refseq: NM_001130997
• Protein Refseq: NP_001124469
• MIM: 300708
• UniProt ID: Q8N1B3