Recombinant Human CCL8 protein, His-tagged

• Cat.No.: CCL8-37H
• Product Overview: Recombinant Human CCL8 protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection.
• Form: 50 mM Tris, 300 mM NaCl, pH 8.0.
• Molecular Mass: 9.8kDa
• AA Sequence: MHHHHHHQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
• Purity: ＞90%
• Storage: Short Term Storage at 4 centigrade, Long Term Storage at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.2 mg/ml

Gene Information

• Gene Name: CCL8 C-C motif chemokine ligand 8 [ Homo sapiens (human) ]
• Official Symbol: CCL8
• Synonyms: HC14; MCP2; MCP-2; SCYA8; SCYA10
• Gene ID: 6355
• mRNA Refseq: NM_005623
• Protein Refseq: NP_005614
• MIM: 602283
• UniProt ID: P80075