Recombinant Human CCL4L1 Protein, GST-Tagged
Cat.No. : | CCL4L1-0641H |
Product Overview : | Human CCL4L1 full-length ORF (AAI48785.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 37.07 kDa |
AA Sequence : | MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL4L1 chemokine (C-C motif) ligand 4-like 1 [ Homo sapiens ] |
Official Symbol | CCL4L1 |
Synonyms | CCL4L1; chemokine (C-C motif) ligand 4-like 1; CCL4L, chemokine (C C motif) ligand 4 like, SCYA4L, small inducible cytokine A4 like; C-C motif chemokine 4-like; AT744.2; LAG 1; MIP-1-beta; macrophage inflammatory protein-1b2; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; monocyte adherence-induced protein 5-alpha; LAG1; CCL4L; LAG-1; SCYA4L; |
Gene ID | 388372 |
mRNA Refseq | NM_001001435 |
Protein Refseq | NP_001001435 |
MIM | 603782 |
UniProt ID | Q8NHW4 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CCL4L1 Products
Required fields are marked with *
My Review for All CCL4L1 Products
Required fields are marked with *
0
Inquiry Basket