Recombinant Human CCL27 Protein

• Cat.No.: CCL27-017H
• Product Overview: Recombinant human CCL27 protein

Specification

• Description: This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation.
• Species: Human
• Form: Lyophilized
• Protein length: 112
• AA Sequence: MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
• Purity: > 97%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered and lyophilized.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CCL27 chemokine (C-C motif) ligand 27 [ Homo sapiens (human) ]
• Official Symbol: CCL27
• Synonyms: CCL27; chemokine (C-C motif) ligand 27; SCYA27, small inducible cytokine subfamily A (Cys Cys), member 27; C-C motif chemokine 27; ALP; CC chemokine ILC; CTACK; CTAK; cutaneous T cell attracting chemokine; ESkine; IL 11 Ralpha locus chemokine; ILC; PESKY; skinkine; IL-11 Ralpha-locus chemokine; small-inducible cytokine A27; IL-11 R-alpha-locus chemokine; cutaneous T-cell attracting chemokine; cutaneous T-cell-attracting chemokine; small inducible cytokine subfamily A (Cys-Cys), member 27; ESKINE; SCYA27
• Gene ID: 10850
• mRNA Refseq: NM_006664
• Protein Refseq: NP_006655
• MIM: 604833
• UniProt ID: Q9Y4X3