Recombinant Human CCL21 Protein

• Cat.No.: CCL21-48H
• Product Overview: Recombinant Human CCL21 Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 111 amino acid
• Description: CCL21 is a human chemokine that recruits normal immune cells and metastasizing tumor cells to lymph nodes through activation of the G protein-coupled receptor CCR7. Originally called SLC or exodus-2, CCL21 is expressed in high endothelial venules of lymph nodes, spleen, and Peyer's patches as well as lymphatic endothelium in peripheral tissues. CCL21 directs the migration of CCR7-expressing lymphocytes and antigen-activated dendritic cells. CCL21 contains 6 conserved cysteines, in contrast to the 4 that are more typical of CC chemokines. CCL21 induces chemotactic migration of thymocytes and activated T-cells, but not B-cells, macrophages, or neutrophils.
• Form: Lyophilized
• Molecular Mass: 12.2472 kDa
• AA Sequence: SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCAD PKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
• Endotoxin: Endotoxin-free <0.01 EU/ug
• Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR
• Storage: Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
• tmpcolum67: C-C motif chemokine ligand 21

Gene Information

• Gene Name: CCL21 C-C motif chemokine ligand 21 [ Homo sapiens (human) ]
• Official Symbol: CCL21
• Synonyms: ECL; SLC; CKb9; TCA4; 6Ckine; SCYA21
• Gene ID: 6366
• mRNA Refseq: NM_002989
• Protein Refseq: NP_002980
• MIM: 602737
• UniProt ID: O00585