Recombinant Human CCL19 Protein

• Cat.No.: CCL19-46H
• Product Overview: Recombinant Human CCL19 Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 77 amino acid
• Description: CCL19 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine. Originally termed MIP-3beta or ELC, CCL19 is expressed in thymus and lymph nodes. The cognate receptor for CCL19 is CCR7 and directs the trafficking of B and T cells.
• Form: Lyophilized
• Molecular Mass: 8.79626 kDa
• AA Sequence: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPW VERIIQRLQRTSAKMKRRSS
• Endotoxin: Endotoxin-free <0.01 EU/ug
• Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR
• Storage: Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
• tmpcolum67: C-C motif chemokine ligand 19

Gene Information

• Gene Name: CCL19 C-C motif chemokine ligand 19 [ Homo sapiens (human) ]
• Official Symbol: CCL19
• Synonyms: ELC; CKb11; MIP3B; MIP-3b; SCYA19
• Gene ID: 6363
• mRNA Refseq: NM_006274
• Protein Refseq: NP_006265
• MIM: 602227
• UniProt ID: Q99731