Recombinant Human CCL17 Protein

Cat.No. : CCL17-10H
Product Overview : Recombinant Human CCL17 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Thymus and activation regulated chemokine (TARC), also known as CCL17, is a chemokine that is constitutively produced by thymus tissue and activated peripheral blood mononuclear cells (PBMCs), including dendritic cells. TARC signals through the CCR4 receptor to induce chemotaxis of Type 2 T helper (Th2) cells. TARC is important in asthma and allergic diseases, along with bacterial and viral infections.
Source : E. coli
Species : Human
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 8.1 kDa (71 aa)
AA Sequence : ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens (human) ]
Official Symbol CCL17
Synonyms CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; CC chemokine TARC; T cell-directed CC chemokine; small-inducible cytokine A17; thymus and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17; ABCD-2; SCYA17; A-152E5.3; MGC138271; MGC138273;
Gene ID 6361
mRNA Refseq NM_002987
Protein Refseq NP_002978
MIM 601520
UniProt ID Q92583

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL17 Products

Required fields are marked with *

My Review for All CCL17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon