Recombinant Human CCL14 Protein, GST-Tagged
Cat.No. : | CCL14-0609H |
Product Overview : | Human CCL14 full-length ORF (AAH45165, 20 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009] |
Molecular Mass : | 33.88 kDa |
AA Sequence : | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL14 chemokine (C-C motif) ligand 14 [ Homo sapiens ] |
Official Symbol | CCL14 |
Synonyms | CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015; |
Gene ID | 6358 |
mRNA Refseq | NM_032962 |
Protein Refseq | NP_116738 |
MIM | 601392 |
UniProt ID | Q16627 |
◆ Recombinant Proteins | ||
CCL14-81H | Recombinant Human CCL14 Protein, Biotin-tagged | +Inquiry |
CCL14-1309H | Recombinant Human CCL14 Protein (Thr20-Asn93), C-His tagged | +Inquiry |
CCL14-110H | Recombinant Human CCL14 Protein, Mature chain, Tag Free, Biotinylated | +Inquiry |
CCL14-167H | Recombinant Human CCL14, His-tagged | +Inquiry |
CCL14-10836H | Recombinant Human CCL14, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL14-7732HCL | Recombinant Human CCL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL14 Products
Required fields are marked with *
My Review for All CCL14 Products
Required fields are marked with *
0
Inquiry Basket