Recombinant Human CCDC25 Protein, GST-Tagged

• Cat.No.: CCDC25-0540H
• Product Overview: Human CCDC25 full-length ORF (AAH32588.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CCDC25 (Coiled-Coil Domain Containing 25) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42.9 kDa
• AA Sequence: MDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC25 coiled-coil domain containing 25 [ Homo sapiens ]
• Official Symbol: CCDC25
• Synonyms: CCDC25; coiled-coil domain containing 25; coiled-coil domain-containing protein 25; FLJ10853
• Gene ID: 55246
• mRNA Refseq: NM_018246
• Protein Refseq: NP_060716
• UniProt ID: Q86WR0