Recombinant Human CCDC25 Protein, GST-Tagged

Cat.No. : CCDC25-0540H
Product Overview : Human CCDC25 full-length ORF (AAH32588.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CCDC25 (Coiled-Coil Domain Containing 25) is a Protein Coding gene.
Molecular Mass : 42.9 kDa
AA Sequence : MDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKVENMSSNQDGNDSDEFM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC25 coiled-coil domain containing 25 [ Homo sapiens ]
Official Symbol CCDC25
Synonyms CCDC25; coiled-coil domain containing 25; coiled-coil domain-containing protein 25; FLJ10853;
Gene ID 55246
mRNA Refseq NM_018246
Protein Refseq NP_060716
UniProt ID Q86WR0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC25 Products

Required fields are marked with *

My Review for All CCDC25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon