Recombinant Human CCDC105 protein, His-tagged
Cat.No. : | CCDC105-2773H |
Product Overview : | Recombinant Human CCDC105 protein(NP_775753)(151-499 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 151-499 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | VRQLLRQREVTDHRLSEVRKGLLINQQSVKLRGYRPKSEKVPDKADSMLTWEKEELKSMKRKMERDMEKSEVLLKTLASCRDTLNFCFKERLQAVDLMNQPLDKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKRLLVESKDTLVEMAKNEVDVREQQLQISDRVCASLAQKASETLELKERLNMTLGLMRGTILRCTKYNQELYTTHGLIKGPLSKVHLETAEKLDRPLVRMYQRHVGTQLPEAARLAQGTDKLQCHITYLEKNLEELLATHKNLTWGLNCKNIGHEVDGNVVRLRLRQRQPHVCYEQAQRLVKDWDPRTPPPRSKSSADP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CCDC105 coiled-coil domain containing 105 [ Homo sapiens (human) ] |
Official Symbol | CCDC105 |
Gene ID | 126402 |
mRNA Refseq | NM_173482 |
Protein Refseq | NP_775753 |
UniProt ID | Q8IYK2 |
◆ Recombinant Proteins | ||
CCDC105-5213H | Recombinant Human CCDC105 Protein, GST-tagged | +Inquiry |
CCDC105-3836HF | Recombinant Full Length Human CCDC105 Protein, GST-tagged | +Inquiry |
CCDC105-1168R | Recombinant Rat CCDC105 Protein | +Inquiry |
CCDC105-826R | Recombinant Rat CCDC105 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC105-2772H | Recombinant Human CCDC105 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC105 Products
Required fields are marked with *
My Review for All CCDC105 Products
Required fields are marked with *
0
Inquiry Basket