Recombinant Human CCAAT/enhancer Binding Protein(C/EBP) α, His-tagged

• Cat.No.: CEBPA-94H
• Product Overview: Recombinant HumanCEBP-α (residues 270-358) was purified by ion-exchange chromatography and FPLC gel-filtration chromatography. Recombinant Human CEBP-α His-Tag fusion proein produced in E.Coli is a single, non-glycosylated polypeptide chain containing amino acids 126 and having a molecular mass of 14.5 kDa

Specification

• Cat. No.: CEBPA-94H
• Description: CCAAT/enhancer binding protein(C/EBP) α is a family of transcription factors that all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and that form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBPs differ significantly in their physiological functions and in their downstream target genes. For example, mice lacking C/EBP α die shortly after birth due to severe hypoglycemia and the absence of glycogen storage in liver, whereas knockout of C/EBP β causes defects in female reproduction.
• Source: Escherichia Coli.
• Amino Acid Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLS RELDTLRGIF RQLPESSLVKAMGNCA
• Physical Appearance: Sterile filtered clorless solution.
• Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by reducing and non-reducing SDS-PAGE Coomassie
• Formulation: The protein (0.87mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol
• Applications: • ELISA • Inhibition Assays• Western Blotting
• Storage: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
• Protein length: 270-358 a.a.

Gene Information

• Gene Name: CEBPA CCAAT/enhancer binding protein (C/EBP), alpha [ Homo sapiens ]
• Synonyms: CEBPA; C/EBP-alpha; CEBP; CCAAT/enhancer binding protein alpha; CCAAT/enhancer binding protein (C/EBP), alpha
• Gene ID: 1050
• mRNA Refseq: NM_004364
• Protein Refseq: NP_004355
• MIM: 601626
• UniProt ID: P49715
• Chromosome Location: 19q13.1
• Pathway: Acute myeloid leukemia; Pathways in cancer
• Function: RNA polymerase II transcription factor activity, enhancer binding; protein dimerization activity; sequence-specific DNA binding; transcription factor binding