Recombinant Human CCAAT/enhancer Binding Protein(C/EBP) α, His-tagged

Cat.No. : CEBPA-94H
Product Overview : Recombinant HumanCEBP-α (residues 270-358) was purified by ion-exchange chromatography and FPLC gel-filtration chromatography. Recombinant Human CEBP-α His-Tag fusion proein produced in E.Coli is a single, non-glycosylated polypeptide chain containing amino acids 126 and having a molecular mass of 14.5 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 270-358 a.a.
Description : CCAAT/enhancer binding protein(C/EBP) α is a family of transcription factors that all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and that form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBPs differ significantly in their physiological functions and in their downstream target genes. For example, mice lacking C/EBP α die shortly after birth due to severe hypoglycemia and the absence of glycogen storage in liver, whereas knockout of C/EBP β causes defects in female reproduction.
Amino Acid Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLS RELDTLRGIF RQLPESSLVKAMGNCA
Physical Appearance : Sterile filtered clorless solution.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by reducing and non-reducing SDS-PAGE Coomassie
Formulation : The protein (0.87mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol
Applications : • ELISA • Inhibition Assays• Western Blotting
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Gene Name CEBPA CCAAT/enhancer binding protein (C/EBP), alpha [ Homo sapiens ]
Synonyms CEBPA; C/EBP-alpha; CEBP; CCAAT/enhancer binding protein alpha; CCAAT/enhancer binding protein (C/EBP), alpha
Gene ID 1050
mRNA Refseq NM_004364
Protein Refseq NP_004355
MIM 601626
UniProt ID P49715
Chromosome Location 19q13.1
Pathway Acute myeloid leukemia; Pathways in cancer
Function RNA polymerase II transcription factor activity, enhancer binding; protein dimerization activity; sequence-specific DNA binding; transcription factor binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CEBPA Products

Required fields are marked with *

My Review for All CEBPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon