Recombinant Human CBX3 protein, GST-tagged

• Cat.No.: CBX3-268H
• Product Overview: Recombinant Human CBX3(1 a.a. - 183 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1 a.a. - 183 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 45.87 kDa
• AA Sequence: MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEA FLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMLLMKWKDSDEADL VLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CBX3 chromobox homolog 3 [ Homo sapiens ]
• Official Symbol: CBX3
• Synonyms: CBX3; chromobox homolog 3; chromobox homolog 3 (Drosophila HP1 gamma); chromobox protein homolog 3; HP1 gamma homolog (Drosophila); HP1Hs gamma; HP1 gamma homolog; modifier 2 protein; heterochromatin-like protein 1; heterochromatin protein HP1 gamma; heterochromatin protein 1 homolog gamma; chromobox homolog 3 (HP1 gamma homolog, Drosophila); HECH; HP1-GAMMA; HP1Hs-gamma
• Gene ID: 11335
• mRNA Refseq: NM_007276
• Protein Refseq: NP_009207
• MIM: 604477
• UniProt ID: Q13185
• Chromosome Location: 7p15.2
• Pathway: Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Gene Expression, organism-specific biosystem; RNA Polymerase I Chain Elongation, organism-specific biosystem; RNA Polymerase I Transcription, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem
• Function: enzyme binding; identical protein binding; protein binding; protein domain specific binding