Recombinant Human CAV3 protein, GST-tagged
Cat.No. : | CAV3-18H |
Product Overview : | Recombinant Human CAV3(1 a.a. - 151 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-151 a.a. |
Description : | This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 43.7 kDa |
AA Sequence : | MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRL LSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKE V |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CAV3 caveolin 3 [ Homo sapiens ] |
Official Symbol | CAV3 |
Synonyms | CAV3; caveolin 3; caveolin-3; LGMD1C; LQT9; M caveolin; VIP 21; VIP21; M-caveolin; VIP-21; MGC126100; MGC126101; MGC126129; |
Gene ID | 859 |
mRNA Refseq | NM_001234 |
Protein Refseq | NP_001225 |
MIM | 601253 |
UniProt ID | P56539 |
Chromosome Location | 3p25 |
Pathway | Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function | nitric-oxide synthase binding; protein C-terminus binding; protein binding; protein complex binding; protein complex scaffold; sodium channel regulator activity; |
◆ Recombinant Proteins | ||
CAV3-92H | Recombinant Human caveolin 3 | +Inquiry |
CAV3-1327HFL | Recombinant Full Length Human CAV3 Protein, C-Flag-tagged | +Inquiry |
CAV3-633H | Recombinant Human CAV3 Protein, His&GST-tagged | +Inquiry |
CAV3-1260M | Recombinant Mouse CAV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAV3-678HF | Recombinant Full Length Human CAV3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAV3-7819HCL | Recombinant Human CAV3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAV3 Products
Required fields are marked with *
My Review for All CAV3 Products
Required fields are marked with *
0
Inquiry Basket