Recombinant Human CAV3 protein, GST-tagged

• Cat.No.: CAV3-18H
• Product Overview: Recombinant Human CAV3(1 a.a. - 151 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-151 a.a.
• Description: This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.7 kDa
• AA Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRL LSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKE V
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CAV3 caveolin 3 [ Homo sapiens ]
• Official Symbol: CAV3
• Synonyms: CAV3; caveolin 3; caveolin-3; LGMD1C; LQT9; M caveolin; VIP 21; VIP21; M-caveolin; VIP-21; MGC126100; MGC126101; MGC126129
• Gene ID: 859
• mRNA Refseq: NM_001234
• Protein Refseq: NP_001225
• MIM: 601253
• UniProt ID: P56539
• Chromosome Location: 3p25
• Pathway: Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem
• Function: nitric-oxide synthase binding; protein C-terminus binding; protein binding; protein complex binding; protein complex scaffold; sodium channel regulator activity