Recombinant Human CASP8 Protein(217–374aa), His-tagged

• Cat.No.: CASP8-4937H
• Product Overview: Recombinant Human CASP8 Protein(217–374aa)(Q14790), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 217–374aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.9kDa
• AA Sequence: SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CASP8 caspase 8, apoptosis-related cysteine peptidase [ Homo sapiens ]
• Official Symbol: CASP8
• Synonyms: CASP8; caspase 8, apoptosis-related cysteine peptidase; caspase 8, apoptosis related cysteine protease; caspase-8; Casp 8; FLICE; MACH; MCH5; FADD-like ICE; MACH-alpha-1/2/3 protein; apoptotic protease Mch-5; MACH-beta-1/2/3/4 protein; apoptotic cysteine protease; ICE-like apoptotic protease 5; MORT1-associated ced-3 homolog; FADD-homologous ICE/CED-3-like protease; caspase 8, apoptosis-related cysteine protease; CAP4; ALPS2B; Casp-8; FLJ17672; MGC78473
• Gene ID: 841
• mRNA Refseq: NM_001080124
• Protein Refseq: NP_001073593
• MIM: 601763
• UniProt ID: Q14790