Recombinant Human CASP7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CASP7-3432H |
Product Overview : | CASP7 MS Standard C13 and N15-labeled recombinant protein (NP_203125) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of the encoded protein is cleaved by caspase 3 and 10, is activated upon cell death stimuli and induces apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 34.3 kDa |
AA Sequence : | MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CASP7 caspase 7 [ Homo sapiens (human) ] |
Official Symbol | CASP7 |
Synonyms | CASP7; caspase 7, apoptosis-related cysteine peptidase; caspase 7, apoptosis related cysteine protease; caspase-7; CMH 1; ICE LAP3; MCH3; CASP-7; Lice2 alpha/beta/gamma; caspase 7 isoform delta; apoptotic protease MCH-3; ICE-like apoptotic protease 3; caspase 7, apoptosis-related cysteine protease; CMH-1; ICE-LAP3; |
Gene ID | 840 |
mRNA Refseq | NM_033339 |
Protein Refseq | NP_203125 |
MIM | 601761 |
UniProt ID | P55210 |
◆ Recombinant Proteins | ||
CASP7-681H | Recombinant Human CASP7 Protein, His-tagged | +Inquiry |
CASP7-2755M | Recombinant Mouse CASP7 Protein | +Inquiry |
CASP7-1246M | Recombinant Mouse CASP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASP7-602H | Recombinant Human Caspase 7, Apoptosis-related Cysteine Peptidase | +Inquiry |
CASP7-6396H | Recombinant Human CASP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP7-7832HCL | Recombinant Human CASP7 293 Cell Lysate | +Inquiry |
CASP7-7833HCL | Recombinant Human CASP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASP7 Products
Required fields are marked with *
My Review for All CASP7 Products
Required fields are marked with *
0
Inquiry Basket