Recombinant Human CASP10 Protein, His-tagged
| Cat.No. : | CASP10-299H |
| Product Overview : | Recombinant Human CASP10, transcript variant 1, fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with type IIA autoimmune lymphoproliferative syndrome, non-Hodgkin lymphoma and gastric cancer. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Form : | Supplied as a 0.2 µM filtered solution of 25mM HEPES, 10mM DTT, pH 7.5 |
| Molecular Mass : | 30.1kD |
| AA Sequence : | MVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | CASP10 caspase 10, apoptosis-related cysteine peptidase [ Homo sapiens ] |
| Official Symbol | CASP10 |
| Synonyms | CASP10; caspase 10, apoptosis-related cysteine peptidase; caspase 10, apoptosis related cysteine protease; caspase-10; MCH4; CASP-10; FADD-like ICE2; apoptotic protease MCH-4; ICE-like apoptotic protease 4; interleukin-1B-converting enzyme 2; caspase 10, apoptosis-related cysteine protease; FAS-associated death domain protein interleukin-1B-converting enzyme 2; ALPS2; FLICE2; |
| Gene ID | 843 |
| mRNA Refseq | NM_001206524 |
| Protein Refseq | NP_116759 |
| MIM | 601762 |
| UniProt ID | Q92851 |
| ◆ Recombinant Proteins | ||
| CASP10-300H | Recombinant Human CASP10 Protein, His-tagged | +Inquiry |
| CASP10-2924HF | Recombinant Full Length Human CASP10 Protein, GST-tagged | +Inquiry |
| CASP10-597H | Recombinant Human Caspase 10, Apoptosis-related Cysteine Peptidase | +Inquiry |
| CASP10-26815TH | Recombinant Human CASP10 | +Inquiry |
| CASP10-247H | Active Recombinant Human CASP10, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP10 Products
Required fields are marked with *
My Review for All CASP10 Products
Required fields are marked with *
