Recombinant Human CASP1 protein, GST-tagged

• Cat.No.: CASP1-2634H
• Product Overview: Recombinant Human CASP1 protein(P29466)(120-269aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 120-269aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.8 kDa
• AA Sequence: NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CASP1 caspase 1, apoptosis-related cysteine peptidase [ Homo sapiens ]
• Official Symbol: CASP1
• Synonyms: CASP1; caspase 1, apoptosis-related cysteine peptidase; caspase 1, apoptosis related cysteine peptidase (interleukin 1, beta, convertase) , caspase 1, apoptosis related cysteine protease (interleukin 1, beta, convertase) , IL1BC; caspase-1; caspase 1; ICE; interleukin 1; beta; convertase; IL1B-convertase; CASP1 nirs variant 1; IL-1 beta-converting enzyme; interleukin 1, beta, convertase; interleukin 1-B converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase); P45; IL1BC
• Gene ID: 834
• mRNA Refseq: NM_001223
• Protein Refseq: NP_001214
• MIM: 147678
• UniProt ID: P29466