Recombinant Human CASC3 Protein, GST-Tagged

• Cat.No.: CASC3-0408H
• Product Overview: Human CASC3 partial ORF (NP_031385, 604 a.a. - 703 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The product of this gene is a core component of the exon junction complex (EJC), a protein complex that is deposited on spliced mRNAs at exon-exon junctions and functions in nonsense-mediated mRNA decay (NMD). The encoded protein binds RNA and interacts with two other EJC core components. It is predominantly located in the cytoplasm, but shuttles into the nucleus where it localizes to nuclear speckles. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: VSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CASC3 cancer susceptibility candidate 3 [ Homo sapiens ]
• Official Symbol: CASC3
• Synonyms: CASC3; cancer susceptibility candidate 3; protein CASC3; BTZ; MLN51; MLN 51; barentsz; protein barentsz; metastatic lymph node 51; metastatic lymph node gene 51 protein; cancer susceptibility candidate gene 3 protein
• Gene ID: 22794
• mRNA Refseq: NM_007359
• Protein Refseq: NP_031385
• MIM: 606504
• UniProt ID: O15234