Recombinant Human CAPZA1
Cat.No. : | CAPZA1-26237TH |
Product Overview : | Recombinant fragment of Human CAPZA1 with an N terminal proprietary tag; Predicted MWt 35.42 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 89 amino acids |
Description : | CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein.The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. |
Molecular Weight : | 35.420kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWN |
Sequence Similarities : | Belongs to the F-actin-capping protein alpha subunit family. |
Gene Name | CAPZA1 capping protein (actin filament) muscle Z-line, alpha 1 [ Homo sapiens ] |
Official Symbol | CAPZA1 |
Synonyms | CAPZA1; capping protein (actin filament) muscle Z-line, alpha 1; F-actin-capping protein subunit alpha-1; |
Gene ID | 829 |
mRNA Refseq | NM_006135 |
Protein Refseq | NP_006126 |
MIM | 601580 |
Uniprot ID | P52907 |
Chromosome Location | 1p13.2 |
Pathway | Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; |
Function | actin binding; |
◆ Recombinant Proteins | ||
CAPZA1-1128R | Recombinant Rat CAPZA1 Protein | +Inquiry |
CAPZA1-626R | Recombinant Rhesus monkey CAPZA1 Protein, His-tagged | +Inquiry |
CAPZA1-1870H | Recombinant Human CAPZA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CAPZA1-7064C | Recombinant Chicken CAPZA1 | +Inquiry |
CAPZA1-118H | Recombinant Human CAPZA1 protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPZA1-7853HCL | Recombinant Human CAPZA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAPZA1 Products
Required fields are marked with *
My Review for All CAPZA1 Products
Required fields are marked with *
0
Inquiry Basket