Recombinant Human CAPZA1

• Cat.No.: CAPZA1-26237TH
• Product Overview: Recombinant fragment of Human CAPZA1 with an N terminal proprietary tag; Predicted MWt 35.42 kDa.

Specification

• Description: CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein.The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments.
• Protein length: 89 amino acids
• Molecular Weight: 35.420kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWN
• Sequence Similarities: Belongs to the F-actin-capping protein alpha subunit family.
• Tag: Non

Gene Information

• Gene Name: CAPZA1 capping protein (actin filament) muscle Z-line, alpha 1 [ Homo sapiens ]
• Official Symbol: CAPZA1
• Synonyms: CAPZA1; capping protein (actin filament) muscle Z-line, alpha 1; F-actin-capping protein subunit alpha-1
• Gene ID: 829
• mRNA Refseq: NM_006135
• Protein Refseq: NP_006126
• MIM: 601580
• Uniprot ID: P52907
• Chromosome Location: 1p13.2
• Pathway: Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem
• Function: actin binding